PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0035s0230.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family ARF
Protein Properties Length: 604aa    MW: 66645.8 Da    PI: 8.0167
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0035s0230.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.21.8e-24133233198
                             EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEE CS
                      B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvF 82 
                             f+kvlt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF
  SapurV1A.0035s0230.2.p 133 FCKVLTASDTSTHGGFSVLRKHATEClppldMTQPTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVF 219
                             99****************************9666677789*********************************************** PP

                             EE-SSSEE..EEEEE- CS
                      B3  83 kldgrsefelvvkvfr 98 
                                + +++el+v+v+r
  SapurV1A.0035s0230.2.p 220 L--RGENGELRVGVRR 233
                             *..449999*****98 PP

2Auxin_resp106.43.1e-35259338183
              Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                             a+ha+st+s F v+Y+Pr+  s+F+++++k+++a+++k+ vGmRfkm+fe+eds+ rr+sGt+vgv+d++p +W++SkWrsLk
  SapurV1A.0035s0230.2.p 259 ASHAVSTQSLFVVYYKPRT--SQFIISLNKYLEAVSNKFVVGMRFKMRFEGEDSPDRRFSGTIVGVEDFSP-HWNDSKWRSLK 338
                             789***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.49E-40123262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-41124248IPR015300DNA-binding pseudobarrel domain
CDDcd100173.37E-21131233No hitNo description
SMARTSM010195.6E-24133235IPR003340B3 DNA binding domain
PROSITE profilePS5086312.308133235IPR003340B3 DNA binding domain
PfamPF023621.6E-22133233IPR003340B3 DNA binding domain
PfamPF065072.0E-32259338IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MMAMNRGAGG GGGSFSQGNS EGCGGDDLYT ELWKACSGPL VDVPKRGERV FYFPQGHMEQ  60
LEASTNQELN QRVPLFNLPS KILCRVIHTQ LLAEQDTDEV YAQITLLPES DQVEPTSPDS  120
SPSEPPRPTV HSFCKVLTAS DTSTHGGFSV LRKHATECLP PLDMTQPTPT QELVAKDLHG  180
YEWRFKHIFR GQPRRHLLTT GWSTFVTSKR LVAGDSFVFL RGENGELRVG VRRVACQQSS  240
MPSSVISSQS MHLGVLATAS HAVSTQSLFV VYYKPRTSQF IISLNKYLEA VSNKFVVGMR  300
FKMRFEGEDS PDRRFSGTIV GVEDFSPHWN DSKWRSLKAQ WDEPAPIPRP DRVSPWEIEP  360
CVASAPTNLS QPVTQKNKRP RPPIEIPALD LSSTASTPWN SGLTQSHDLT QLSGTGEGKS  420
YENHVMRHQK QTDVNGRHSN SLTRNQTEGG WLASPHVNVS QHLFQDSMED SKSVSPWPVF  480
SGYSTPLSSK SKNDPIPDPS DKGRKSEVPA SYRLFGIDLV NHSLSSTPIE VPAQPMSICS  540
GATEGHGLGT LSAVDSDQKS EASKEQKPEQ LQKSPKEIQS KQSSTSTRSR TKVLKIRISC  600
LFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17813601354Auxin response factor 1
4ldw_A1e-17813601354Auxin response factor 1
4ldw_B1e-17813601354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1377381KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026848.10.0PREDICTED: LOW QUALITY PROTEIN: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLB9RYN10.0B9RYN1_RICCO; Auxin response factor
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9